PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00337g02001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 139aa    MW: 15797.3 Da    PI: 10.3166
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00337g02001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof115.42.4e-3666126262
                    zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                               + +a+kcprCds ntkfCyynny+l qPr+fC++ rryWtkGG lrnvPvGgg+rknk+s+
  Niben101Scf00337g02001.1  66 QPQAVKCPRCDSLNTKFCYYNNYNLCQPRHFCQSRRRYWTKGGILRNVPVGGGCRKNKRSK 126
                               56899*****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2464124IPR003851Zinc finger, Dof-type
PfamPF027013.5E-3068124IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.4170124IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 139 aa     Download sequence    Send to blast
MEEAAIPSQI PKSANIEPCL KIHRKNCTSN FLRSILSKIC KIYIQLEVAE GGFTAVGGDR  60
RLRLNQPQAV KCPRCDSLNT KFCYYNNYNL CQPRHFCQSR RRYWTKGGIL RNVPVGGGCR  120
KNKRSKPKRS AVSTNDDTC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1122128KRSKPKR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009786397.16e-45PREDICTED: dof zinc finger protein DOF5.4-like
RefseqXP_016473712.12e-44PREDICTED: dof zinc finger protein DOF5.4-like
SwissprotQ8LDR05e-36DOF54_ARATH; Dof zinc finger protein DOF5.4
TrEMBLA0A068TRH11e-38A0A068TRH1_COFCA; Uncharacterized protein
STRINGVIT_17s0000g04850.t017e-36(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.13e-37OBF binding protein 4